PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA54G00004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 338aa    MW: 37451.8 Da    PI: 9.3922
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA54G00004genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.2e-10191249563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 kr++r   NR +A rs +RK +++ eLe+kv++L++e ++L  ++ +l+   + l +e+
  AA54G00004 191 KRAKRILANRQSAARSKERKIKYTGELERKVQTLQNEATTLSAQVTMLQRGTSDLNTEN 249
                 9********************************************99998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-14187251IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611189252IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-10191246No hitNo description
SuperFamilySSF579597.03E-11191241No hitNo description
PfamPF001707.9E-9191249IPR004827Basic-leucine zipper domain
CDDcd147033.77E-22192240No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007231Biological Processosmosensory signaling pathway
GO:0008272Biological Processsulfate transport
GO:0009294Biological ProcessDNA mediated transformation
GO:0009652Biological Processthigmotropism
GO:0009970Biological Processcellular response to sulfate starvation
GO:0045596Biological Processnegative regulation of cell differentiation
GO:0051170Biological Processnuclear import
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
GO:0051019Molecular Functionmitogen-activated protein kinase binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEGSLRANHT IPTEIDRMPD LPRHRISHHR RARSDTFFSG ESFDDLLLFD PSDAYFSSLD  60
FLATPTTPQP SQVSPMSVDS PEESSSNAPP LPLPPRDLPK PDVRVGRHFR SFSVDSDFLD  120
DIGAAEDQFS GKTLATSSGE KGGNHHRSLS MDGATSSESF NIESILASVS SKKNMGMGGD  180
RLAELALLDP KRAKRILANR QSAARSKERK IKYTGELERK VQTLQNEATT LSAQVTMLQR  240
GTSDLNTENK HLKMRLQALE QQAELRDALN NALRDELNRL RIAAGETPPG NRNSYSRAPP  300
LTMHHQFGKH KNQEMGSSLS TKNGQPLQAS FMDFTKRG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00184DAPTransfer from AT1G43700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002891267.11e-158vire2-interacting protein VIP1
SwissprotQ9MA751e-155VIP1_ARATH; Transcription factor VIP1
TrEMBLD7KNM81e-158D7KNM8_ARALL; Vire2-interacting protein VIP1
STRINGfgenesh2_kg.1__3729__AT1G43700.11e-158(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79932639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G43700.11e-127VIRE2-interacting protein 1